🔴 only for medical professionals 🔴
🔴 only for medical professionals 🔴
$107.99
$95.99/vial for 10 vials
$83.99/vial for 50 vials
Contact for wholesale orders
| Unit Size | 10 mg/ vials |
| Unit Quantity | 1 Amber Vials |
| Molecular Formula | C215H350N62O71 |
| Molecular Weight | 4493.11 |
| Sequence | [LL-37, 37 aa] |
| Appearance | White Powder |
| Peptide Purity | >98.1% |
| Solubility | Soluble in water or 1% acetic acid |
LL-37 (CAP-18)
LL-37, a 37-amino-acid cathelicidin peptide, exhibits antimicrobial and immunomodulatory effects by disrupting bacterial membranes and modulating immune responses through receptors like FPRL1 and TLRs. It promotes wound healing, angiogenesis, and cytokine release while suppressing excessive inflammation, making it a candidate for treating infections, chronic wounds, and inflammatory disorders.
A detailed answer to provide information about your business, build trust with potential customers, or help the visitor with a problem they may be encountering
A detailed answer to provide information about your business, build trust with potential customers, or help the visitor with a problem they may be encountering
A detailed answer to provide information about your business, build trust with potential customers, or help the visitor with a problem they may be encountering
A detailed answer to provide information about your business, build trust with potential customers, or help the visitor with a problem they may be encountering
A detailed answer to provide information about your business, build trust with potential customers, or help the visitor with a problem they may be encountering
A detailed answer to provide information about your business, build trust with potential customers, or help the visitor with a problem they may be encountering
A detailed answer to provide information about your business, build trust with potential customers, or help the visitor with a problem they may be encountering
A detailed answer to provide information about your business, build trust with potential customers, or help the visitor with a problem they may be encountering
